Cagrilintide
Price range: $70.00 through $110.00
Long-acting amylin analog studied in metabolic research.
Description
Long-acting amylin analog studied in metabolic research. Supplied strictly for laboratory and in-vitro research use — not for human or veterinary consumption.
Cagrilintide is a long-acting analogue of human amylin, carrying the disulfide ring characteristic of the amylin family together with a C20 fatty-diacid side chain. It is supplied as a lyophilised powder and, as with other acylated peptides, the acetate counter-ion from purification is not a separately registered salt.
| Compound | Cagrilintide |
|---|---|
| Also known as | AM833, NN0174-0833 |
| Class | Acylated 37-residue amylin analogue |
| Structure | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, with an intramolecular Cys-Cys disulfide bridge, a C-terminal amide, and a lipidated lysine bearing a Îł-Glu spacer and eicosanedioic (C20) diacid. |
| Molecular formula | C194H312N54O59S2 |
| Molecular weight | 4409.0 g/mol |
| CAS number | 1415456-99-3 |
| Appearance | White to off-white lyophilised powder. |
| Purity specification | ≥98% by HPLC |
Every lot ships against its own certificate of analysis. Search by lot number on the certificates of analysis page, or check the paperwork before you order.
Cagrilintide is supplied for laboratory research use only. It is not a drug, food or cosmetic, and it is not for human or veterinary use.
| Reconstitution | Bacteriostatic water or sterile water. The fatty-diacid side chain can make this one slow to go into solution - swirl gently and allow time rather than shaking. |
|---|---|
| Storage, lyophilised | -20 °C, sealed and desiccated, protected from light. |
| Storage, reconstituted | 2-8 °C, protected from light. Use within 2-4 weeks, or freeze single-use aliquots at -20 °C for longer holds. |
| Shipping | Shipped at ambient temperature. Lyophilised material tolerates transit without a cold chain; move it to the freezer on arrival. |
Working notes
- Let a vial come to room temperature before opening it. Opening a cold vial draws in moist air, and lyophilised powder takes up water quickly.
- Add the diluent slowly down the inside wall of the vial rather than directly onto the powder cake, and let it dissolve on its own. Shaking a peptide solution is the fastest way to denature it.
- Wipe the stopper with alcohol before every draw, and keep solutions out of direct light.
- Repeated freeze-thaw cycles cost you more purity than time in the fridge does. If a vial will be used over weeks, aliquot it once and freeze the aliquots.
Additional Information
| Size | 5mg, 10mg |
|---|
Related products
-
Cagrilintide + Semaglutide Blend
Price range: $85.00 through $135.00 Add to Cart This product has multiple variants. The options may be chosen on the product page -
Tirzepatide
$140.00 Add to Cart This product has multiple variants. The options may be chosen on the product page -
GLP-3R
$140.00 Add to Cart This product has multiple variants. The options may be chosen on the product page -
Semaglutide
Price range: $30.00 through $40.00 Add to Cart This product has multiple variants. The options may be chosen on the product page
Reviews
There are no reviews yet.